Join Our Mailing List Today!

NOTICE: Online ordering will be disabled 1/27-2/3. Learn More.

Recombinant Mouse IL-19

In stock
Catalog ID
200-75
Size Stock SKU Unit Price Qty
10 µg In Stock 200-75-10UG
$190.00
    100 µg In Stock 200-75-100UG
    $733.00
      500 µg Inquire for Availability 200-75-500UG
      $3,643.00
        1 mg Inquire for Availability 200-75-1MG
        $6,073.00
          10 µg (Animal-Free) In Stock 200-75AF-10UG
          $208.00
            100 µg (Animal-Free) In Stock 200-75AF-100UG
            $804.00
              500 µg (Animal-Free) Inquire for Availability 200-75AF-500UG
              $4,011.00
                1 mg (Animal-Free) Inquire for Availability 200-75AF-1MG
                $6,679.00
                  reset
                  Details

                  Interleukin-19 (IL-19) is a member of the interleukin 10 (IL-10) cytokine family and is produced by B cells and monocytes. IL-19 binds the interleukin 20 receptor complex (IL-20R) to activate STAT3 signaling. IL-19 induces interleukin 6 (IL-6) and tumor necrosis factor alpha (TNF-α) expression in monocytes, and promotes type 2 T helper (Th2) cell-mediated immune responses. IL-19 production is upregulated in resting monocytes following granulocyte-macrophage colony-stimulating factor (GM-CSF) or lipopolysaccharide (LPS) stimulation.

                  Product images on the website are not representative of actual product, including, but not limited to differences in cap color, tube type, or label format.

                  Instructions

                  Centrifuge vial before opening. Suspend the product by gently pipetting the above recommended solution down the sides of the vial. DO NOT VORTEX. Allow several minutes for complete reconstitution. For prolonged storage, dilute to working aliquots in a 0.1% BSA solution, store at -80°C and avoid repeat freeze thaws.

                  Technical Specifications

                  Accession Number Q8CJ70
                  Source Genetically modified E.coli
                  Predicted Molecular Mass Monomer, 17.7 kDa (153 aa)
                  AA Sequence MLRRCLISVDMRLIEKSFHEIKRAMQTKDTFKNVTILSLENLRSIKPGDVCCMTNNLLTFYRDRVFQDHQERSLEVLRRISSIANSFLCVQKSLERCQVHRQCNCSQEATNATRIIHDNYNQLEVSSAALKSLGELNILLAWIDRNHLETPAA
                  Formulation Lyophilized from a 0.2 µm filtered solution containing 10 mM sodium phosphate, 50 mM sodium chloride, pH 7.5
                  Product Reconstitution Sterile water at 0.1 mg/mL
                  Country of Origin USA

                   

                  Specification* Method of Determination Acceptance Criteria
                  Purity Reducing and Non-Reducing SDS PAGE ≥ 95%
                  Endotoxin Kinetic LAL ≤ 0.1 EU/µg
                  Biological Activity (ED50) No biological activity data is available at this time No biological activity data is available at this time

                   

                  *Lot-specific values for the above specifications are supplied with each product on its corresponding COA.  The values provided here are minimum expected values to pass internal requirements.

                  Specifications

                  Storage
                  At or below -20°C
                  Shelf Life
                  12 months from date of receipt when stored at -20°C to-80°C as supplied.
                  © 2025 FUJIFILM Irvine Scientific. All rights reserved.