Recombinant Mouse IL-19

In stock

Catalog ID

200-75

Size	Stock	SKU	Unit Price
10 µg	In Stock	200-75-10UG	$183.00
100 µg	In Stock	200-75-100UG	$705.00
500 µg	Inquire for Availability	200-75-500UG	$3,503.00
1 mg	Inquire for Availability	200-75-1MG	$5,839.00
10 µg (Animal-Free)	In Stock	200-75AF-10UG	$200.00
100 µg (Animal-Free)	In Stock	200-75AF-100UG	$773.00
500 µg (Animal-Free)	Inquire for Availability	200-75AF-500UG	$3,857.00
1 mg (Animal-Free)	Inquire for Availability	200-75AF-1MG	$6,422.00

Find Your Distributor

Skip to the end of the images gallery

Skip to the beginning of the images gallery

Details

Interleukin-19 (IL-19) is a member of the interleukin 10 (IL-10) cytokine family and is produced by B cells and monocytes. IL-19 binds the interleukin 20 receptor complex (IL-20R) to activate STAT3 signaling. IL-19 induces interleukin 6 (IL-6) and tumor necrosis factor alpha (TNF-α) expression in monocytes, and promotes type 2 T helper (Th2) cell-mediated immune responses. IL-19 production is upregulated in resting monocytes following granulocyte-macrophage colony-stimulating factor (GM-CSF) or lipopolysaccharide (LPS) stimulation.

Product images on the website are not representative of actual product, including, but not limited to differences in cap color, tube type, or label format.

Instructions

Centrifuge vial before opening. Suspend the product by gently pipetting the above recommended solution down the sides of the vial. DO NOT VORTEX. Allow several minutes for complete reconstitution. For prolonged storage, dilute to working aliquots in a 0.1% BSA solution, store at -80°C and avoid repeat freeze thaws.

Technical Specifications

Accession Number	Q8CJ70
Source	Genetically modified E.coli
Predicted Molecular Mass	Monomer, 17.7 kDa (153 aa)
AA Sequence	MLRRCLISVDMRLIEKSFHEIKRAMQTKDTFKNVTILSLENLRSIKPGDVCCMTNNLLTFYRDRVFQDHQERSLEVLRRISSIANSFLCVQKSLERCQVHRQCNCSQEATNATRIIHDNYNQLEVSSAALKSLGELNILLAWIDRNHLETPAA
Formulation	Lyophilized from a 0.2 µm filtered solution containing 10 mM sodium phosphate, 50 mM sodium chloride, pH 7.5
Product Reconstitution	Sterile water at 0.1 mg/mL
Country of Origin	USA

Specification*	Method of Determination	Acceptance Criteria
Purity	Reducing and Non-Reducing SDS PAGE	≥ 95%
Endotoxin	Kinetic LAL	≤ 0.1 EU/µg
Biological Activity (ED₅₀)	No biological activity data is available at this time	No biological activity data is available at this time

*Lot-specific values for the above specifications are supplied with each product on its corresponding COA. The values provided here are minimum expected values to pass internal requirements.

Specifications

Storage

At or below -20°C

Shelf Life

12 months from date of receipt when stored at -20°C to-80°C as supplied.

FAQs

Recombinant Proteins FAQs

COA Search

Certificate of Analysis Search